Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nkx2-5 antibody - N-terminal region (ARP36946_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

NK2 transcription factor related, locus 5 (Drosophila)

Gene Aliases

Cs, ti, Csx, Nkx2., Nkx-2., Nkx2.5, tinman, Nkx-2.5

Gene ID

18091

Swiss Prot

P42582

Accession Number

NP_032726

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Nkx2-5

Target

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.

Partner Proteins

Tbx5; Foxh1; Hand2; Hand1; Mef2c; Tbx1; Prox1; Smarca4; SRF

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 80%; Mouse: 100%; Rabbit: 86%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

318

NCBI Gene Symbol

NKX2-5

Host or Source

Rabbit

Protein Name

Homeobox protein Nkx-2.5

Gene Name URL

Nkx2-5

Nucleotide Accession Number

NM_008700

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Cellulolyticum rplW Protein (aa 1-117)
VAng-Lsx9017-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Cellulolyticum rplW Protein (aa 1-117)

Sign In for Pricing
View Details
KIR3DS1 Polyclonal Conjugated Antibody
MBS9442945-01 0.1 mL (Biotin)

KIR3DS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KIR3DS1 Polyclonal Conjugated Antibody
MBS9442945-02 0.1 mL (AF350)

KIR3DS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KIR3DS1 Polyclonal Conjugated Antibody
MBS9442945-03 0.1 mL (AF405)

KIR3DS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KIR3DS1 Polyclonal Conjugated Antibody
MBS9442945-04 0.1 mL (AF488)

KIR3DS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KIR3DS1 Polyclonal Conjugated Antibody
MBS9442945-05 0.1 mL (AF555)

KIR3DS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details