Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxa3 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Forkhead box A3

Gene Aliases

Hnf3, Hnf-3, Hnf3g, Tcf3g, Hnf-3g, Tcf-3g

Gene ID

15377

Swiss Prot

P35584

Accession Number

NP_032286

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Foxa3

Target

Foxa3 is a transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Foxa3 is originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Foxa3 interacts with the cis-acting regulatory regions of these genes.Foxa3 is involved in glucose homeostasis; activates GLUT2 transcription and regulation of neuronal-specific transcription. Foxa3 is also involved in regulation of spermatogenesis; required for the maintenance of the testicular germ cell population and male fertility.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37kDa

Protein Length

353

NCBI Gene Symbol

FOXA3

Host or Source

Rabbit

Protein Name

Hepatocyte nuclear factor 3-gamma

Gene Name URL

Foxa3

Nucleotide Accession Number

NM_008260

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpysl2 3'UTR Luciferase Stable Cell Line
TU105379 1.0 mL

Dpysl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human ZNF569 Protein
E30P3450 20 µg

Recombinant Human ZNF569 Protein

Sign In for Pricing
View Details
AATK (Apoptosis Associated Tyrosine Kinase, AATYK, LMR1, p35BP, Serine/Threonine- Protein Kinase LMTK1, Lemur Tyrosine Kinase 1, Brain apoptosis-associated tyrosine kinase, CDK5-binding protein, p35-binding protein)
361948 200 µL

AATK (Apoptosis Associated Tyrosine Kinase, AATYK, LMR1, p35BP, Serine/Threonine- Protein Kinase LMTK1, Lemur Tyrosine Kinase 1, Brain apoptosis-associated tyrosine kinase, CDK5-binding protein, p35-binding protein)

Sign In for Pricing
View Details
Cipc (NM_001289432) Mouse Untagged Clone
MC227134 10 µg

Cipc (NM_001289432) Mouse Untagged Clone

Sign In for Pricing
View Details
Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (APC)
MBS6268744-01 0.1 mL

Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (APC)

Sign In for Pricing
View Details
Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (APC)
MBS6268744-02 5x 0.1 mL

Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (APC)

Sign In for Pricing
View Details