What is the catalog number for Gcm1 Antibody - middle region?

The catalog number for Gcm1 Antibody - middle region is ARP36862_P050-25UL.

What sizes are available for Gcm1 Antibody - middle region?

Gcm1 Antibody - middle region is available in the following size(s): 25 µL.

Is Gcm1 Antibody - middle region in stock?

Gcm1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

Gcm1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Glial cells missing homolog 1 (Drosophila)

Gene Aliases

GCM, gli, GCMa, glide, Gcm1-r, Gcm-rs2, Gcm1-rs1

Gene ID

14531

Swiss Prot

P70348

Accession Number

NP_032129

Reactivity

Mouse, Rat

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Gcm1

Target

Transcription factor that is necessary for placental development

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol