What is the catalog number for Acd Antibody - C-terminal region?

The catalog number for Acd Antibody - C-terminal region is ARP36813_P050-25UL.

What sizes are available for Acd Antibody - C-terminal region?

Acd Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Acd Antibody - C-terminal region in stock?

Acd Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

Acd Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Adrenocortical dysplasia

Gene ID

497652

Swiss Prot

Q5EE38

Accession Number

NP_001012656

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Acd

Target

Acd is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.Acd promotes binding of POT1 to single-stranded telomeric DNA.Acd modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.Acd plays a role in shelterin complex assembly. Acd may play an essential role in organogenesis of the developing embryo.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol