Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK6 antibody - N-terminal region (ARP36723_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium channel, subfamily K, member 6

Gene Aliases

TOSS, KCNK8, TWIK2, K2p6.1, TWIK-2

Gene ID

9424

Swiss Prot

Q9Y257

Accession Number

NP_004814

Reactivity

Human, Cow, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KCNK6

Target

KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Human: 100%; Pig: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

313

NCBI Gene Symbol

KCNK6

Host or Source

Rabbit

Protein Name

Potassium channel subfamily K member 6

Gene Name URL

KCNK6

Nucleotide Accession Number

NM_004823

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZR1 (Fizzy-related Protein Homolog, Fzr, CDC20-like Protein 1, Cdh1/Hct1 Homolog, hCDH1, CDH1, FYR, FZR, KIAA1242) APC
MBS6136690-01 0.1 mL

FZR1 (Fizzy-related Protein Homolog, Fzr, CDC20-like Protein 1, Cdh1/Hct1 Homolog, hCDH1, CDH1, FYR, FZR, KIAA1242) APC

Sign In for Pricing
View Details
FZR1 (Fizzy-related Protein Homolog, Fzr, CDC20-like Protein 1, Cdh1/Hct1 Homolog, hCDH1, CDH1, FYR, FZR, KIAA1242) APC
MBS6136690-02 5x 0.1 mL

FZR1 (Fizzy-related Protein Homolog, Fzr, CDC20-like Protein 1, Cdh1/Hct1 Homolog, hCDH1, CDH1, FYR, FZR, KIAA1242) APC

Sign In for Pricing
View Details
Human PRAME family member 4 (PRAMEF4) ELISA Kit
MBS280440-01 48 Tests

Human PRAME family member 4 (PRAMEF4) ELISA Kit

Sign In for Pricing
View Details
Human PRAME family member 4 (PRAMEF4) ELISA Kit
MBS280440-02 96 Tests

Human PRAME family member 4 (PRAMEF4) ELISA Kit

Sign In for Pricing
View Details
Human PRAME family member 4 (PRAMEF4) ELISA Kit
MBS280440-03 5x 96 Tests

Human PRAME family member 4 (PRAMEF4) ELISA Kit

Sign In for Pricing
View Details
Human PRAME family member 4 (PRAMEF4) ELISA Kit
MBS280440-04 10x 96 Tests

Human PRAME family member 4 (PRAMEF4) ELISA Kit

Sign In for Pricing
View Details