What is the catalog number for GJD3 Antibody - C-terminal region?

The catalog number for GJD3 Antibody - C-terminal region is ARP36632_P050-25UL.

What sizes are available for GJD3 Antibody - C-terminal region?

GJD3 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is GJD3 Antibody - C-terminal region in stock?

GJD3 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

GJD3 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Gap junction protein, delta 3, 31.9kDa

Gene Aliases

GJC1, GJA11, CX31.9, Cx30.2

Gene ID

125111

Swiss Prot

Q8N144

Accession Number

NP_689343

Reactivity

Human

Target

This gene is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Partner Proteins

TJP1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol