Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA4 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Gap junction protein, alpha 4, 37kDa

Gene Aliases

CX37

Gene ID

2701

Swiss Prot

P35212

Accession Number

NP_002051

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJA4

Target

GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%; Sheep: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37 kDa

Protein Length

333

NCBI Gene Symbol

GJA4

Host or Source

Rabbit

Protein Name

Gap junction alpha-4 protein

Gene Name URL

GJA4

Nucleotide Accession Number

NM_002060

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carboxypeptidase N catalytic chain (CPN1) ELISA Kit
AE59015HU-01 48 Tests

Human Carboxypeptidase N catalytic chain (CPN1) ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase N catalytic chain (CPN1) ELISA Kit
AE59015HU-02 96 Tests

Human Carboxypeptidase N catalytic chain (CPN1) ELISA Kit

Sign In for Pricing
View Details
GTPBP4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV699011 1.0 µg DNA

GTPBP4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human Inositol-trisphosphate 3-kinase B Protein, His-SUMO, E.coli-500ug
QP6243-ec-500ug 500ug

Recombinant Human Inositol-trisphosphate 3-kinase B Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
Anti-Siglec-2 / CD22 Reference Antibody (pinatuzumab)
M01572-6 100 µg

Anti-Siglec-2 / CD22 Reference Antibody (pinatuzumab)

Sign In for Pricing
View Details
TUFML sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2560805 3x 1.0 µg

TUFML sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details