What is the catalog number for GJA4 antibody - middle region (ARP36603_P050)?

The catalog number for GJA4 antibody - middle region (ARP36603_P050) is ARP36603_P050.

What sizes are available for GJA4 antibody - middle region (ARP36603_P050)?

GJA4 antibody - middle region (ARP36603_P050) is available in the following size(s): 100 µL.

Is GJA4 antibody - middle region (ARP36603_P050) in stock?

GJA4 antibody - middle region (ARP36603_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

GJA4 antibody - middle region (ARP36603_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Gap junction protein, alpha 4, 37kDa

Gene Aliases

CX37

Gene ID

2701

Swiss Prot

P35212

Accession Number

NP_002051

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJA4

Target

GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol