Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA7 Antibody - C-terminal region (ARP36595_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cholinergic receptor nicotinic alpha 7 subunit

Gene Aliases

NACHRA7, CHRNA7-2

Gene ID

1139

Swiss Prot

P36544

Accession Number

NP_000737.1

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CHRNA7

Target

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLM

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

55kDa

Protein Length

502

NCBI Gene Symbol

CHRNA7

Host or Source

Rabbit

Protein Name

Neuronal acetylcholine receptor subunit alpha-7

Gene Name URL

CHRNA7

Nucleotide Accession Number

NM_000746.5

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomk Rat siRNA Oligo Duplex (Locus ID 306549)
SR513126 1 Kit

Pomk Rat siRNA Oligo Duplex (Locus ID 306549)

Sign In for Pricing
View Details
Recombinant Rat Epidermal Growth Factor (EGF)
RPU51142-01 50 µg

Recombinant Rat Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Recombinant Rat Epidermal Growth Factor (EGF)
RPU51142-02 100 µg

Recombinant Rat Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Recombinant Rat Epidermal Growth Factor (EGF)
RPU51142-03 1 mg

Recombinant Rat Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
MS4A2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-4870R-APC-Cy7 100 µL

MS4A2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Streptococcus suis Phosphopantetheine adenylyltransferase (coaD)
MBS1117055-01 0.02 mg (E-Coli)

Recombinant Streptococcus suis Phosphopantetheine adenylyltransferase (coaD)

Sign In for Pricing
View Details