Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA8L2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Annexin A8-like 2

Gene Aliases

ANXA8, bA145E20.2

Gene ID

244

Swiss Prot

P13928

Accession Number

NP_001621

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANXA8L2

Target

ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37kDa

Protein Length

327

NCBI Gene Symbol

ANXA8L2

Host or Source

Rabbit

Protein Name

Annexin A8

Gene Name URL

ANXA8L2

Nucleotide Accession Number

NM_001630

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit
MBS7262549-01 48 Well

Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit
MBS7262549-02 96 Well

Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit
MBS7262549-03 5x 96 Well

Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit
MBS7262549-04 10x 96 Well

Monkey Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Apoptosis inhibitor 5 (API5) (NM_001142930) Human Untagged Clone
SC325162 10 µg

Apoptosis inhibitor 5 (API5) (NM_001142930) Human Untagged Clone

Sign In for Pricing
View Details
2,2,3,3-Tetramethylcyclopropanecarboxylic Acid
159807 5 g

2,2,3,3-Tetramethylcyclopropanecarboxylic Acid

Sign In for Pricing
View Details