Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX35 antibody - N-terminal region (ARP36485_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

DEAH (Asp-Glu-Ala-His) box polypeptide 35

Gene Aliases

DDX35, C20orf15, KAIA0875

Gene ID

60625

Swiss Prot

Q9H5Z1

Accession Number

NP_068750

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHX35

Target

DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined.

Partner Proteins

UBC; Prpf8

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

79kDa

Protein Length

703

NCBI Gene Symbol

DHX35

Host or Source

Rabbit

Protein Name

Probable ATP-dependent RNA helicase DHX35

Gene Name URL

DHX35

Nucleotide Accession Number

NM_021931

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPCR discontinued
509175 100 µg

EPCR discontinued

Sign In for Pricing
View Details
Mouse Monoclonal PIN4 Antibody (OTI7H2) [Alexa Fluor 350]
NBP2-73416AF350 0.1 mL

Mouse Monoclonal PIN4 Antibody (OTI7H2) [Alexa Fluor 350]

Sign In for Pricing
View Details
ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 750)
MBS6461795-01 0.1 mL

ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 750)

Sign In for Pricing
View Details
ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 750)
MBS6461795-02 5x 0.1 mL

ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 750)

Sign In for Pricing
View Details
REO-3, REO Virus Type 3 (Rat Sera) EIA, 96 Tests/Kit
SMART-R13 each

REO-3, REO Virus Type 3 (Rat Sera) EIA, 96 Tests/Kit

Sign In for Pricing
View Details
Ppox sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4912405 3x 1.0 µg

Ppox sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details