Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX25 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

DEAD (Asp-Glu-Ala-Asp) box helicase 25

Gene Aliases

GRTH

Gene ID

29118

Swiss Prot

Q9UHL0

Accession Number

NP_037396

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX25

Target

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX25 is a member of this family. The protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDW

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41kDa

Protein Length

369

NCBI Gene Symbol

DDX25

Host or Source

Rabbit

Protein Name

ATP-dependent RNA helicase DDX25

Gene Name URL

DDX25

Nucleotide Accession Number

NM_013264

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tmbim6 shRNA (UAS) - Lentiviral mouse Tmbim6 shRNA (UAS, iRFP) (100)
GTR15193935 1 Vial

Lentiviral mouse Tmbim6 shRNA (UAS) - Lentiviral mouse Tmbim6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human Interleukin 23 ELISA Kit
MBS026757-01 48 Well

Human Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 23 ELISA Kit
MBS026757-02 96 Well

Human Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 23 ELISA Kit
MBS026757-03 5x 96 Well

Human Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 23 ELISA Kit
MBS026757-04 10x 96 Well

Human Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
TA805169S 30 µL

Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1G8]

Sign In for Pricing
View Details