What is the catalog number for EBF2 antibody - middle region (ARP36020_P050)?

The catalog number for EBF2 antibody - middle region (ARP36020_P050) is ARP36020_P050.

What sizes are available for EBF2 antibody - middle region (ARP36020_P050)?

EBF2 antibody - middle region (ARP36020_P050) is available in the following size(s): 100 µL.

Is EBF2 antibody - middle region (ARP36020_P050) in stock?

EBF2 antibody - middle region (ARP36020_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

EBF2 antibody - middle region (ARP36020_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Early B-cell factor 2

Gene Aliases

COE2, OE-3, EBF-2, O/E-3

Gene ID

64641

Swiss Prot

Q9HAK2

Accession Number

NP_073150

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EBF2

Target

EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-103 AU120738.1 302-404 104-650 AL701879.1 1-547 651-735 AC090103.4 79460-79544 736-796 BC069665.1 1-61 797-1794 BC074794.2 1-998 1795-2297 AK021562.1 1082-1584

Partner Proteins

ZNF423

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol