Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF214 antibody - N-terminal region (ARP35859_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Zinc finger protein 214

Gene Aliases

BAZ1, BAZ-1

Gene ID

7761

Swiss Prot

Q9UL59

Accession Number

NP_037381

Reactivity

Human, Dog, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF214

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TNVMSVENWNESYKSQEEKFRYLEYENFSYWQGWWNAGAQMYENQNYGET

Applications

WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Dog: 92%; Horse: 85%; Human: 100%; Rabbit: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

71kDa

Protein Length

606

NCBI Gene Symbol

ZNF214

Host or Source

Rabbit

Protein Name

Zinc finger protein 214

Gene Name URL

ZNF214

Nucleotide Accession Number

NM_013249

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory
MBS649348-01 0.2 mL

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory

Sign In for Pricing
View Details
OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory
MBS649348-02 5x 0.2 mL

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory

Sign In for Pricing
View Details
FOXO3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV687255 1.0 µg DNA

FOXO3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CFB Protein Vector (Mouse) (pPM-C-His)
PV164961 500 ng

CFB Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PLV3-U6-EREG-sgRNA3-Cas9-EGFP-Puro Plasmid
PVT67552 2 µg

PLV3-U6-EREG-sgRNA3-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Caspase-8 (phospho Tyr380) Polyclonal Antibody
RA22743-01 50 µL

Caspase-8 (phospho Tyr380) Polyclonal Antibody

Sign In for Pricing
View Details