What is the catalog number for SOX14 Antibody - middle region?

The catalog number for SOX14 Antibody - middle region is ARP35712_T100-25UL.

What sizes are available for SOX14 Antibody - middle region?

SOX14 Antibody - middle region is available in the following size(s): 25 µL.

Is SOX14 Antibody - middle region in stock?

SOX14 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

SOX14 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

SRY (sex determining region Y) -box 14

Gene Aliases

SOX28

Gene ID

8403

Swiss Prot

O95416

Accession Number

NP_004180

Reactivity

Human, Mouse, Rat, Cow, Goat, Guinea Pig, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOX14

Target

This intronless gene, SOX14, encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in the SOX14 gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.

Partner Proteins

NAIF1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTA

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol