Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH7 antibody - N-terminal region (ARP35484_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel, subfamily H (eag-related), member 7

Gene Aliases

ERG3, HERG3, Kv11.3

Gene ID

90134

Swiss Prot

Q8IV15

Accession Number

NP_775185

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH7

Target

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. There are at least two alternatively spliced transcript variants derived from this gene and encoding distinct isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

83kDa

Protein Length

732

NCBI Gene Symbol

KCNH7

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily H member 7

Gene Name URL

KCNH7

Nucleotide Accession Number

NM_173162

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1371 Protein Vector (Mouse) (pPM-C-His)
PV209149 500 ng

Olfr1371 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MUM1, CT (MUM1, EXPAND1, PWWP domain-containing protein MUM1, Mutated melanoma-associated antigen 1, Protein expandere) (AP) discontinued
038698-AP 200 µL

MUM1, CT (MUM1, EXPAND1, PWWP domain-containing protein MUM1, Mutated melanoma-associated antigen 1, Protein expandere) (AP) discontinued

Sign In for Pricing
View Details
1,6-Anhydro-2-deoxy-2-iodo-β-D-galactopyranose
GC0024-500mg 500 mg

1,6-Anhydro-2-deoxy-2-iodo-β-D-galactopyranose

Sign In for Pricing
View Details
KRT33B, NT (KRT33B, HHA3-II, HKA3B, KRTHA3B, Keratin, type I cuticular Ha3-II, Hair keratin, type I Ha3-II, Keratin-33B) (PE) discontinued
037617-PE 200 µL

KRT33B, NT (KRT33B, HHA3-II, HKA3B, KRTHA3B, Keratin, type I cuticular Ha3-II, Hair keratin, type I Ha3-II, Keratin-33B) (PE) discontinued

Sign In for Pricing
View Details
MCHr1 antagonist 2 50mg
A12379-50 50 mg

MCHr1 antagonist 2 50mg

Sign In for Pricing
View Details
MET (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-protein Kinase Met)
217543 100 µg

MET (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-protein Kinase Met)

Sign In for Pricing
View Details