Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh8 antibody - C-terminal region (ARP35410_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel, subfamily H (eag-related), member 8

Gene Aliases

ELK, ELK1, ELK3, Kv12., Kv12.1, C130090D05Rik

Gene ID

211468

Swiss Prot

P59111

Accession Number

NP_001026981

Reactivity

Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Kcnh8 is a pore-forming (alpha) subunit of voltage-gated potassium channel. It elicits a slowly activating, outward rectifying current. Channel properties may be modulated by cAMP and subunit assembly.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 92%; Rat: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

123kDa

Protein Length

1102

NCBI Gene Symbol

KCNH8

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily H member 8

Gene Name URL

Kcnh8

Nucleotide Accession Number

NM_001031811

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1D (MGC12261, MGC14659, SUNCOR, C1D DNA-binding Protein, Small Unique Nuclear Receptor Corepressor, Nuclear DNA-binding Protein) (Biotin)
124086-Biotin 100 µL

C1D (MGC12261, MGC14659, SUNCOR, C1D DNA-binding Protein, Small Unique Nuclear Receptor Corepressor, Nuclear DNA-binding Protein) (Biotin)

Sign In for Pricing
View Details
IFI35 Antibody (N-term R30) Blocking peptide
MBS9218159-01 0.5 mg

IFI35 Antibody (N-term R30) Blocking peptide

Sign In for Pricing
View Details
IFI35 Antibody (N-term R30) Blocking peptide
MBS9218159-02 5x 0.5 mg

IFI35 Antibody (N-term R30) Blocking peptide

Sign In for Pricing
View Details
SLC27A5 (Solute Carrier Family 27 Member 5, Bile Acid-CoA Ligase, BA-CoA Ligase, BAL, Bile Acyl-CoA Synthetase, BACS, Cholate--CoA Ligase, Fatty Acid Transport Protein 5, FATP5, FATP-5, Fatty-acid-coenzyme A Ligase, Very Long-chain 3, FACVL3, Very Long-chain Acyl-CoA Synthetase Homolog 2, VLCSH2, VLCS-H2, Very Long-chain Acyl-CoA Synthetase-related Protein, VLACS-related, VLACSR, ACSB, ACSVL6) (MaxLight 490)
133465-ML490 100 µL

SLC27A5 (Solute Carrier Family 27 Member 5, Bile Acid-CoA Ligase, BA-CoA Ligase, BAL, Bile Acyl-CoA Synthetase, BACS, Cholate--CoA Ligase, Fatty Acid Transport Protein 5, FATP5, FATP-5, Fatty-acid-coenzyme A Ligase, Very Long-chain 3, FACVL3, Very Long-chain Acyl-CoA Synthetase Homolog 2, VLCSH2, VLCS-H2, Very Long-chain Acyl-CoA Synthetase-related Protein, VLACS-related, VLACSR, ACSB, ACSVL6) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LAM4 Polyclonal Antibody
MBS7157422 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LAM4 Polyclonal Antibody

Sign In for Pricing
View Details
DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (AP) discontinued
034580-AP 200 µL

DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (AP) discontinued

Sign In for Pricing
View Details