Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNV2 antibody - N-terminal region (ARP35396_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium channel, subfamily V, member 2

Gene Aliases

Kv8.2, RCD3B, KV11.1

Gene ID

169522

Swiss Prot

Q8TDN2

Accession Number

NP_598004

Reactivity

Human, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNV2

Target

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a 'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamily members. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channel subunits. KCNV2 is strongly expressed in pancreas and has a weaker expression in several other tissues.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a 'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamily members. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channel subunits. This protein is strongly expressed in pancreas and has a weaker expression in several other tissues.

Partner Proteins

KCNC1; KCNB1; KCNF1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%; Pig: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

62kDa

Protein Length

545

NCBI Gene Symbol

KCNV2

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily V member 2

Gene Name URL

KCNV2

Nucleotide Accession Number

NM_133497

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to STAT5A (Phospho-Tyr694)
35-1047-100 100 µL

Polyclonal Antibody to STAT5A (Phospho-Tyr694)

Sign In for Pricing
View Details
TMCO2 Recombinant Protein (Mouse)
RP179120 100 µg

TMCO2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Ano5 shRNA (UAS) - Lentiviral mouse Ano5 shRNA (UAS, GFP) plasmid
GTR15225670 1 Vial

Lentiviral mouse Ano5 shRNA (UAS) - Lentiviral mouse Ano5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Eif4b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7162007 1.0 µg DNA

Eif4b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant ASFV Ken-098 Protein (aa 1-263)
VAng-0860Lsx-1mg 1 mg

Recombinant ASFV Ken-098 Protein (aa 1-263)

Sign In for Pricing
View Details
RGD1559896 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6029902 1.0 µg DNA

RGD1559896 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details