KCNMB4 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium large conductance calcium-activated channel, subfamily M, beta member 4

Gene ID

27345

Swiss Prot

Q86W47

Accession Number

NP_055320

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4

Target

KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol