Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG4 antibody - N-terminal region (ARP35236_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium channel, voltage-dependent, gamma subunit 4

Gene Aliases

MGC11138, MGC24983

Gene ID

27092

Swiss Prot

Q9UBN1

Accession Number

NP_055220

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG4

Target

L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Partner Proteins

SPP1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36kDa

Protein Length

327

NCBI Gene Symbol

CACNG4

Host or Source

Rabbit

Protein Name

Voltage-dependent calcium channel gamma-4 subunit

Gene Name URL

CACNG4

Nucleotide Accession Number

NM_014405

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a17 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7161302 1.0 µg DNA

Slc22a17 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse Ribosome production factor 1 (Rpf1)
MBS1300478-01 0.02 mg (E-Coli)

Recombinant Mouse Ribosome production factor 1 (Rpf1)

Sign In for Pricing
View Details
Recombinant Mouse Ribosome production factor 1 (Rpf1)
MBS1300478-02 0.02 mg (Yeast)

Recombinant Mouse Ribosome production factor 1 (Rpf1)

Sign In for Pricing
View Details
Recombinant Mouse Ribosome production factor 1 (Rpf1)
MBS1300478-03 0.1 mg (E-Coli)

Recombinant Mouse Ribosome production factor 1 (Rpf1)

Sign In for Pricing
View Details
Recombinant Mouse Ribosome production factor 1 (Rpf1)
MBS1300478-04 0.1 mg (Yeast)

Recombinant Mouse Ribosome production factor 1 (Rpf1)

Sign In for Pricing
View Details
Recombinant Mouse Ribosome production factor 1 (Rpf1)
MBS1300478-05 0.02 mg (Baculovirus)

Recombinant Mouse Ribosome production factor 1 (Rpf1)

Sign In for Pricing
View Details