Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA10 antibody - N-terminal region (ARP35177_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel, shaker-related subfamily, member 10

Gene Aliases

Kcn1, Kv1.8

Gene ID

3744

Swiss Prot

Q16322

Accession Number

NP_005540

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA10

Target

KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.

Partner Proteins

POMP

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 92%; Dog: 79%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

58kDa

Protein Length

511

NCBI Gene Symbol

KCNA10

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily A member 10

Gene Name URL

KCNA10

Nucleotide Accession Number

NM_005549

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p107 (Thr369) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-5981R-PE-Cy5.5 100 µL

Phospho-p107 (Thr369) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
YIPF4 (NM_032312) Human Over-expression Lysate
LS084272-20ug 20 µg

YIPF4 (NM_032312) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TTC33 qPCR Primer Pair
QH36025S 200 Tests

Human TTC33 qPCR Primer Pair

Sign In for Pricing
View Details
CD93 siRNA (Human)
MBS8204964-01 15 nmol

CD93 siRNA (Human)

Sign In for Pricing
View Details
CD93 siRNA (Human)
MBS8204964-02 30 nmol

CD93 siRNA (Human)

Sign In for Pricing
View Details
CD93 siRNA (Human)
MBS8204964-03 5x 30 nmol

CD93 siRNA (Human)

Sign In for Pricing
View Details