Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCNKA antibody - N-terminal region (ARP35132_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Chloride channel, voltage-sensitive Ka

Gene Aliases

CLCK1, ClC-K1, hClC-Ka

Gene ID

1187

Swiss Prot

P51800

Accession Number

NP_004061

Reactivity

Human, Mouse, Rat, Cow, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLCNKA

Target

CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 90%; Human: 100%; Mouse: 85%; Pig: 85%; Rat: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

75kDa

Protein Length

687

NCBI Gene Symbol

CLCNKA

Host or Source

Rabbit

Protein Name

Chloride channel protein ClC-Ka

Gene Name URL

CLCNKA

Nucleotide Accession Number

NM_004070

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Melanocortin receptor 4 (MC4R)
MBS7019948-01 0.02 mg

Recombinant Bovine Melanocortin receptor 4 (MC4R)

Sign In for Pricing
View Details
Recombinant Bovine Melanocortin receptor 4 (MC4R)
MBS7019948-02 0.1 mg

Recombinant Bovine Melanocortin receptor 4 (MC4R)

Sign In for Pricing
View Details
Recombinant Bovine Melanocortin receptor 4 (MC4R)
MBS7019948-03 5x 0.1 mg

Recombinant Bovine Melanocortin receptor 4 (MC4R)

Sign In for Pricing
View Details
Human FGF22 activation kit by CRISPRa
GA108963 1 Kit

Human FGF22 activation kit by CRISPRa

Sign In for Pricing
View Details
C-Abl, CT (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, Proto-oncogene c-Abl, p150, ABL1, JTK7) (MaxLight 550) discontinued
C0013-04L-ML550 100 µL

C-Abl, CT (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, Proto-oncogene c-Abl, p150, ABL1, JTK7) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Research Grade Landogrozumab
MBS1563255-01 0.1 mg

Research Grade Landogrozumab

Sign In for Pricing
View Details