Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB3 Antibody - N-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Cholinergic receptor nicotinic beta 3 subunit

Gene ID

1142

Swiss Prot

Q05901

Accession Number

NP_000740

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACHB3

Target

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of nAChRs are encoded by separate genes and have different primary structure. There are several subtypes of neuronal nAChRs that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if, like muscle alpha-1 (MIM 100690), they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits (Groot Kormelink and Luyten, 1997 [PubMed 9009220]) . Elliott et al. (1996) [PubMed 8906617] stated that the proposed structure for each subunit is a conserved N-terminal extracellular domain followed by 3 conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region.[supplied by OMIM, Apr 2010]

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTD

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

50kDa

Protein Length

458

NCBI Gene Symbol

CHRNB3

Host or Source

Rabbit

Protein Name

Neuronal acetylcholine receptor subunit beta-3

Gene Name URL

CHRNB3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SNX27 Antibody [Alexa Fluor 350]
NBP1-45283AF350 0.1 mL

Rabbit Polyclonal SNX27 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester
orb1986305-01 25 mg

Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester

Sign In for Pricing
View Details
Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester
orb1986305-02 50 mg

Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester

Sign In for Pricing
View Details
Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester
orb1986305-03 100 mg

Carbanilic acid, m- (2-methoxyethoxy) -, 2- (diethylamino) ethyl ester

Sign In for Pricing
View Details
TFF3, Recombinant, Human (Trefoil Factor 3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B) discontinued
220317 20 µg

TFF3, Recombinant, Human (Trefoil Factor 3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B) discontinued

Sign In for Pricing
View Details
Anti-Triadin/TRDN Antibody Picoband®, FITC Conjugate
A06901-FITC 100 µg/Vial

Anti-Triadin/TRDN Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details