What is the catalog number for Cacng1 Antibody - middle region?

The catalog number for Cacng1 Antibody - middle region is ARP34961_P050-25UL.

What sizes are available for Cacng1 Antibody - middle region?

Cacng1 Antibody - middle region is available in the following size(s): 25 µL.

Is Cacng1 Antibody - middle region in stock?

Cacng1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

Cacng1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium channel, voltage-dependent, gamma subunit 1

Gene Aliases

Cacng

Gene ID

29658

Swiss Prot

P97707

Accession Number

NP_062128

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Target

This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Cacng1 plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca2+ channel may function only as a multiple subunit complex.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol