What is the catalog number for Kcnh2 Antibody - C-terminal region?

The catalog number for Kcnh2 Antibody - C-terminal region is ARP34928_P050-25UL.

What sizes are available for Kcnh2 Antibody - C-terminal region?

Kcnh2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Kcnh2 Antibody - C-terminal region in stock?

Kcnh2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Kcnh2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel, subfamily H (eag-related), member 2

Gene Aliases

LQ, ERG, LQT, ERG1, Lqt2, M-er, M-erg, Merg1, merg1a, merg1b, AI326795

Gene ID

16511

Swiss Prot

O35219

Accession Number

NP_038597

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Target

Kcnh2 is a pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. It mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol