What is the catalog number for NKX6-3 Antibody - C-terminal region?

The catalog number for NKX6-3 Antibody - C-terminal region is ARP34488_P050-25UL.

What sizes are available for NKX6-3 Antibody - C-terminal region?

NKX6-3 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is NKX6-3 Antibody - C-terminal region in stock?

NKX6-3 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

NKX6-3 Antibody - C-terminal region

Selected Variant

ARP34488_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

NK6 homeobox 3

Gene Aliases

NKX6.3

Gene ID

157848

Swiss Prot

A6NJ46

Reactivity

Human, Mouse, Rat, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKX6-3

Target

Nkx6.3 is a new member of the Nkx6 subfamily of homeodomain proteins. Members of the Nkx family of homeodomain proteins are involved in a variety of developmental processes such as cell fate determination in the CNS and in the pancreas. Nkx6.3 is expressed in the developing CNS and gastro-intestinal tract. Nkx6.3 shows a remarkably selective expression in a subpopulation of differentiating V2 neurons at caudal hindbrain levels. In the gut, Nkx6.3 is expressed in duodenal and glandular stomach endoderm and at the end of gestation Nkx6.3 became restricted to the base of the gastric units in the glandular stomach.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ESQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDD

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%; Mouse: 83%; Rabbit: 86%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

29kDa

Protein Length

265

NCBI Gene Symbol

NKX6-3

Host or Source

Rabbit

Protein Name

Homeobox protein Nkx-6.3

Gene Name URL