Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCAL1 antibody - N-terminal region (ARP34311_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1

Gene Aliases

HARP, HHARP

Gene ID

50485

Swiss Prot

Q9NZC9

Accession Number

NP_054859

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCAL1

Target

SMARCAL1 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. Mutations in SMARCAL1 gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency. The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.

Partner Proteins

UBC; RPA3; RPA2; RPA1; SULT1A1; Cebpb

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

106kDa

Protein Length

954

NCBI Gene Symbol

SMARCAL1

Host or Source

Rabbit

Protein Name

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1

Gene Name URL

SMARCAL1

Nucleotide Accession Number

NM_014140

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09773C-01 25 µg

FITC Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
FITC Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09773C-02 100 µg

FITC Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
ALDH2 Rabbit Monoclonal Antibody
E56G3998 100 µL

ALDH2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CLCA1 (Chloride Channel Regulator 1, CACC, CACC1, CLCRG1, FLJ95147, GOB5) (APC)
MBS6168389-01 0.1 mL

CLCA1 (Chloride Channel Regulator 1, CACC, CACC1, CLCRG1, FLJ95147, GOB5) (APC)

Sign In for Pricing
View Details
CLCA1 (Chloride Channel Regulator 1, CACC, CACC1, CLCRG1, FLJ95147, GOB5) (APC)
MBS6168389-02 5x 0.1 mL

CLCA1 (Chloride Channel Regulator 1, CACC, CACC1, CLCRG1, FLJ95147, GOB5) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 647]
NBP2-97724AF647 0.1 mL

Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details