Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED26 antibody - N-terminal region (ARP33745_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Mediator complex subunit 26

Gene Aliases

CRSP7, CRSP70

Gene ID

9441

Swiss Prot

O95402

Accession Number

NP_004822

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MED26

Target

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED26 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-261 AC024075.4 20290-20550 c 262-726 AF104253.1 1-465 727-3184 AK128435.1 1414-3871

Partner Proteins

MED19; MED13; MED12; MED21; MED11; TAF8; MED8; MED30; EAF1; MED10; TAF3; MED25; MED28; ICE2; EAF2; MED29; MED9; MED18; MED15; MED31; MED4; AFF4; MED13L; ICE1; CDK19; ELL2; MED16; MED6; MED20; MED7; MED27; MED17; MED23; MED14; ELL; TAF15; TCEB3; TCEA1; TBP

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIE

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

65kDa

Protein Length

600

NCBI Gene Symbol

MED26

Host or Source

Rabbit

Protein Name

Mediator of RNA polymerase II transcription subunit 26

Gene Name URL

MED26

Nucleotide Accession Number

NM_004831

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHA (NM_001135239) Human Tagged ORF Clone Lentiviral Particle
RC225375L3V 200 µL

LDHA (NM_001135239) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SPD304 dihydrochloride
MBS3615087-01 5 mg

SPD304 dihydrochloride

Sign In for Pricing
View Details
SPD304 dihydrochloride
MBS3615087-02 10 mg

SPD304 dihydrochloride

Sign In for Pricing
View Details
SPD304 dihydrochloride
MBS3615087-03 25 mg

SPD304 dihydrochloride

Sign In for Pricing
View Details
SPD304 dihydrochloride
MBS3615087-04 50 mg

SPD304 dihydrochloride

Sign In for Pricing
View Details
SPD304 dihydrochloride
MBS3615087-05 100 mg

SPD304 dihydrochloride

Sign In for Pricing
View Details