Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr0b1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

AH, AHX, Ahc, Dax, Ahch, DAX-, Dax1, DAX-1

Gene ID

11614

Swiss Prot

Q61066

Accession Number

NP_031456

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr0b1

Target

Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.

Partner Proteins

Nanog; Nr4a1; Zfp609; Wdr5; Ogt; Pelo; Sall4; Snw1; Rif1; Esrrb; Trim28; Sp1; Rest; Pou5f1; Prmt1; Hnf4a; Sall1; Nr5a1; Nr5a2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 92%; Dog: 75%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

52kDa

Protein Length

472

NCBI Gene Symbol

NR0B1

Host or Source

Rabbit

Protein Name

Nuclear receptor subfamily 0 group B member 1

Gene Name URL

Nr0b1

Nucleotide Accession Number

NM_007430

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4536-3p miRNA Mimic
CMH1730-01 5 nmol

Hsa-miR-4536-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4536-3p miRNA Mimic
CMH1730-02 10 nmol

Hsa-miR-4536-3p miRNA Mimic

Sign In for Pricing
View Details
Mouse monoclonal Secernin-1 Antibody (OTI1F2)
NBP2-45727 0.1 mL

Mouse monoclonal Secernin-1 Antibody (OTI1F2)

Sign In for Pricing
View Details
Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424300-01 0.12 mL

Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424300-02 0.2 mL

Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424300-03 5x 0.2 mL

Rabbit Anti Human NEGR1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details