What is the catalog number for ARID3A Antibody - middle region?

The catalog number for ARID3A Antibody - middle region is ARP32869_P050-25UL.

What sizes are available for ARID3A Antibody - middle region?

ARID3A Antibody - middle region is available in the following size(s): 25 µL.

Is ARID3A Antibody - middle region in stock?

ARID3A Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

ARID3A Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

AT rich interactive domain 3A (BRIGHT-like)

Gene Aliases

DRIL1, DRIL3, BRIGHT, E2FBP1

Gene ID

1820

Swiss Prot

Q99856

Accession Number

NP_005215

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARID3A

Target

ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.

Partner Proteins

NOTCH2NL; TTC32; UBC; SOX2; TP53BP1; APP; UBE2E3; TP53; SP100; PML; E2F4; E2F2; RL2; ELAVL1; SUMO2; BTK; E2F1; DSP

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol