Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX1 antibody - C-terminal region (ARP32866_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Distal-less homeobox 1

Gene ID

1745

Swiss Prot

P56177

Accession Number

NP_835221

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1

Target

DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.

Partner Proteins

SMAD4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

27kDa

Protein Length

255

NCBI Gene Symbol

DLX1

Host or Source

Rabbit

Protein Name

Homeobox protein DLX-1

Gene Name URL

DLX1

Nucleotide Accession Number

NM_178120

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEBP-gamma Recombinant Protein
PROTP53567-100ug 100 µg

Human CEBP-gamma Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Cd44 shRNA (UAS) - Lentiviral mouse Cd44 shRNA (UAS, RFP) (100)
GTR15198108 1 Vial

Lentiviral mouse Cd44 shRNA (UAS) - Lentiviral mouse Cd44 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rat Monoclonal PD-1 Antibody (766104) [Janelia Fluor 549]
FAB7738I 0.1 mL

Rat Monoclonal PD-1 Antibody (766104) [Janelia Fluor 549]

Sign In for Pricing
View Details
ENO3 (NM_001976) Human Untagged Clone
SC118914 10 µg

ENO3 (NM_001976) Human Untagged Clone

Sign In for Pricing
View Details
CFHR5 (Complement Factor H-related Protein 5, FHR-5, CFHL5, FHR5, FLJ10549, MGC133240) (MaxLight 550)
MBS6373803-01 0.1 mL

CFHR5 (Complement Factor H-related Protein 5, FHR-5, CFHL5, FHR5, FLJ10549, MGC133240) (MaxLight 550)

Sign In for Pricing
View Details
CFHR5 (Complement Factor H-related Protein 5, FHR-5, CFHL5, FHR5, FLJ10549, MGC133240) (MaxLight 550)
MBS6373803-02 5x 0.1 mL

CFHR5 (Complement Factor H-related Protein 5, FHR-5, CFHL5, FHR5, FLJ10549, MGC133240) (MaxLight 550)

Sign In for Pricing
View Details