What is the catalog number for Smad6 Antibody - C-terminal region?

The catalog number for Smad6 Antibody - C-terminal region is ARP32689_P050-25UL.

What sizes are available for Smad6 Antibody - C-terminal region?

Smad6 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Smad6 Antibody - C-terminal region in stock?

Smad6 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

Smad6 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

SMAD family member 6

Gene Aliases

Madh, Madh6, b2b390C, b2b390Clo

Gene ID

17130

Swiss Prot

O35182

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Smad6

Target

Smad6 binds to regulatory elements in target promoter regions. It may block the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. It acts as a mediator of TGF-beta and BMP antiflammatory activity. It suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes.

Partner Proteins

Smurf1; Tbx6; Bmpr2; Bmpr1a; Acvr1; Runx2; tob1a; Axin1; SMURF2; BMPR1B

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol