Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD1 antibody - C-terminal region (ARP32644_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Homeobox D1

Gene Aliases

HOX4, HOX4G, Hox-4.7

Gene ID

3231

Swiss Prot

Q9GZZ0

Accession Number

NP_078777

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD1

Target

HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

HOXC9

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 90%; Dog: 100%; Guinea Pig: 92%; Horse: 90%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 90%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

328

NCBI Gene Symbol

HOXD1

Host or Source

Rabbit

Protein Name

Homeobox protein Hox-D1

Gene Name URL

HOXD1

Nucleotide Accession Number

NM_024501

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A10 Protein Lysate (Mouse) with C-HA Tag
43892035 100 µg

SLC16A10 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TNFRSF19L, Recombinant, Human, His-Tag, Fc-Tag discontinued
046894 100 µg

TNFRSF19L, Recombinant, Human, His-Tag, Fc-Tag discontinued

Sign In for Pricing
View Details
Recombinant Clostridium perfringens toxin NetB Protein, N-His
YXX23802 100 μg

Recombinant Clostridium perfringens toxin NetB Protein, N-His

Sign In for Pricing
View Details
PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat
E-PP-1697-01 1 mg

PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat

Sign In for Pricing
View Details
PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat
E-PP-1697-02 10 mg

PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat

Sign In for Pricing
View Details
PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat
E-PP-1697-03 5 mg

PACAP-38 (6-38), human, chicken, mouse, ovine, porcine, rat

Sign In for Pricing
View Details