SUV39H1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Suppressor of variegation 3-9 homolog 1 (Drosophila)

Gene Aliases

MG44, KMT1A, SUV39H, H3-K9-HMTase 1

Gene ID

6839

Swiss Prot

O43463

Accession Number

NP_003164

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SUV39H1

Target

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su (var) 3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis. This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

LZTS2; CEP70; HOOK2; CBX5; KRTAP10-7; HIST2H3A; CDCA4; KLHDC4; GTPBP2; ZNF581; ZCCHC17; CRBN; ING4; DCAF8; KLF15; KLHL20; PHF19; IL16; IGFBP4; ID2; ID1; HOXC4; HOXA1; FYN; FUS; EZH2; CLK3; ATP6V1B1; ATF3; GTF2H2C_2; H3F3C; LHX8; STX19; C17orf82; ZNF829; C

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol