Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUV39H1 antibody - C-terminal region (ARP32470_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Suppressor of variegation 3-9 homolog 1 (Drosophila)

Gene Aliases

MG44, KMT1A, SUV39H, H3-K9-HMTase 1

Gene ID

6839

Swiss Prot

O43463

Accession Number

NP_003164

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1

Target

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su (var) 3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

LZTS2; CEP70; HOOK2; CBX5; KRTAP10-7; HIST2H3A; CDCA4; KLHDC4; GTPBP2; ZNF581; ZCCHC17; CRBN; ING4; DCAF8; KLF15; KLHL20; PHF19; IL16; IGFBP4; ID2; ID1; HOXC4; HOXA1; FYN; FUS; EZH2; CLK3; ATP6V1B1; ATF3; GTF2H2C_2; H3F3C; LHX8; STX19; C17orf82; ZNF829; C

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

Applications

IHC, WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

48kDa

Protein Length

412

NCBI Gene Symbol

SUV39H1

Host or Source

Rabbit

Protein Name

Histone-lysine N-methyltransferase SUV39H1

Gene Name URL

SUV39H1

Nucleotide Accession Number

NM_003173

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fbxo28 Pre-designed siRNA Set A
SI204940A 1 Each

Rat Fbxo28 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Spark Blue™ 515 anti-human HLA-DR
GT08720 25 Tests

Spark Blue™ 515 anti-human HLA-DR

Sign In for Pricing
View Details
ADAM12 Blocking Peptide
abx161006-01 1 mg

ADAM12 Blocking Peptide

Sign In for Pricing
View Details
ADAM12 Blocking Peptide
abx161006-02 5 mg

ADAM12 Blocking Peptide

Sign In for Pricing
View Details
TRIM54 3'UTR Lenti-reporter-Luc Vector
47802081 1.0 µg

TRIM54 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse UPK3A siRNA
abx939076-01 15 nmol

Mouse UPK3A siRNA

Sign In for Pricing
View Details