What is the catalog number for ZNF449 Antibody - C-terminal region?

The catalog number for ZNF449 Antibody - C-terminal region is ARP32254_P050-25UL.

What sizes are available for ZNF449 Antibody - C-terminal region?

ZNF449 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is ZNF449 Antibody - C-terminal region in stock?

ZNF449 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

ZNF449 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Zinc finger protein 449

Gene Aliases

ZSCAN19

Gene ID

203523

Swiss Prot

Q6P9G9

Accession Number

NP_689908

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF449

Target

ZNF449 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 SCAN box domain. ZNF449 may be involved in transcriptional regulation.

Partner Proteins

SCAND1; UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol