Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX3 antibody - N-terminal region (ARP31605_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Distal-less homeobox 3

Gene Aliases

AI4, TDO

Gene ID

1747

Swiss Prot

O60479

Accession Number

NP_005211

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLX3

Target

DLX3 is a member of the Dlx gene family which contains a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less homeo box (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

TDP2; TBL1X; PRKCA

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVN

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

32kDa

Protein Length

287

NCBI Gene Symbol

DLX3

Host or Source

Rabbit

Protein Name

Homeobox protein DLX-3

Gene Name URL

DLX3

Nucleotide Accession Number

NM_005220

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Src Antibody
NBP2-38165 0.1 mL

Rabbit Polyclonal Src Antibody

Sign In for Pricing
View Details
PDE6C antibody - C-terminal region
MBS3216488-01 0.1 mL

PDE6C antibody - C-terminal region

Sign In for Pricing
View Details
PDE6C antibody - C-terminal region
MBS3216488-02 5x 0.1 mL

PDE6C antibody - C-terminal region

Sign In for Pricing
View Details
C9orf152 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0273405 3x 1.0 µg

C9orf152 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine FRS2 ELISA Kit
EBF0132 96 Tests

Bovine FRS2 ELISA Kit

Sign In for Pricing
View Details
Human Band 4.1-like protein 1,EPB41L1 ELISA KIT
JOT-EK7378Hu 96 wells

Human Band 4.1-like protein 1,EPB41L1 ELISA KIT

Sign In for Pricing
View Details