Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR13C5 Antibody - middle region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Olfactory receptor, family 13, subfamily C, member 5

Gene Aliases

OR9-11

Gene ID

138799

Swiss Prot

Q8NGS8

Accession Number

NP_001004482

Reactivity

Human, Rat, Cow, Dog, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OR13C5

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 86%; Rat: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36kDa

Protein Length

318

NCBI Gene Symbol

OR13C5

Host or Source

Rabbit

Protein Name

Olfactory receptor 13C5

Gene Name URL

OR13C5

Nucleotide Accession Number

NM_001004482

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt7a ORF Vector (Mouse) (pORF)
50457014 1.0 µg DNA

Wnt7a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TULP3 Protein Vector (Human) (pPB-N-His)
PV044678 500 ng

TULP3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
AQP3, ID (AQP3, Aquaporin-3, Aquaglyceroporin-3) (MaxLight 750)
MBS6274652-01 0.1 mL

AQP3, ID (AQP3, Aquaporin-3, Aquaglyceroporin-3) (MaxLight 750)

Sign In for Pricing
View Details
AQP3, ID (AQP3, Aquaporin-3, Aquaglyceroporin-3) (MaxLight 750)
MBS6274652-02 5x 0.1 mL

AQP3, ID (AQP3, Aquaporin-3, Aquaglyceroporin-3) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human LIF Protein (His-tag)
GB300023-H-10μg 10 μg

Recombinant Human LIF Protein (His-tag)

Sign In for Pricing
View Details
Phospho-SMO-S616 Rabbit pAb
AP0938-01 20 µL

Phospho-SMO-S616 Rabbit pAb

Sign In for Pricing
View Details