What is the catalog number for IKZF1 Antibody - middle region?

The catalog number for IKZF1 Antibody - middle region is ARP31470_P050-25UL.

What sizes are available for IKZF1 Antibody - middle region?

IKZF1 Antibody - middle region is available in the following size(s): 25 µL.

Is IKZF1 Antibody - middle region in stock?

IKZF1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

IKZF1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

IKAROS family zinc finger 1 (Ikaros)

Gene Aliases

IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452

Gene ID

10320

Swiss Prot

Q13422

Accession Number

NP_006051

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IKZF1

Target

IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.

Partner Proteins

PRKAB2; PIN1; FGF12; DDX6; DCX; CTBP2; CTBP1; CKS1B; BYSL; FAM74A4; C1orf174; CEP57L1; ALKBH3; ZMAT2; ZNF417; FRMD6; SPATC1L; FAM161A; FAM214B; ARMC7; NOC4L; SCNM1; C8orf33; AEN; GMCL1P1; KIF9; SH2D4A; CBX8; LMO3; C19orf66; C1orf109; SYT17; ZNF581; FAM50B

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol