Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 1 protein (FGF1) (Active)

Product Specifications

Product Name Alternative

FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

Abbreviation

Recombinant Human FGF1 protein (Active)

Gene Name

FGF1

UniProt

P05230

Expression Region

2-155aa

Organism

Homo sapiens (Human)

Target Sequence

AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:20145243, ECO:0000269|PubMed:8663044}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 106 IU/mg in the presence of 10 μg/ml of heparin.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gfi1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6403305 3x 1.0 µg

Gfi1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Nav1.8 Antibody
MBS9612000-01 0.1 mL

Nav1.8 Antibody

Sign In for Pricing
View Details
Nav1.8 Antibody
MBS9612000-02 0.2 mL

Nav1.8 Antibody

Sign In for Pricing
View Details
Nav1.8 Antibody
MBS9612000-03 5x 0.2 mL

Nav1.8 Antibody

Sign In for Pricing
View Details
TRAIL CRISPR/Cas9 KO Plasmid (h)
sc-418124 20 µg

TRAIL CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
PDCD6 Protein Lysate
OCOA11462-20UG 20 µg

PDCD6 Protein Lysate

Sign In for Pricing
View Details