Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 protein (IL6) (Active)

Product Specifications

Product Name Alternative

IL-6, BSF-2, CTL differentiation factor, CDF, Hybridoma growth factor

Abbreviation

Recombinant Human IL6 protein (Active)

Gene Name

IL6

UniProt

P05231

Expression Region

30-212aa

Organism

Homo sapiens (Human)

Target Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 107 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 x106 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF780B Human Gene Knockout Kit (CRISPR)
KN414988 1 Kit

ZNF780B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF740 conjugate, 0.1mg/mL
BNC740502-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fmoc-Val Wang Resin LL
HLL0751501327.25G 25 g

Fmoc-Val Wang Resin LL

Sign In for Pricing
View Details
(7R)-Salutaridinol
TRC-S100655-1MG 1 mg

(7R)-Salutaridinol

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 0.2mg/mL
BNUB1948-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 0.2mg/mL

Sign In for Pricing
View Details
CD45RB (BRA-11G), CF568 conjugate, 0.1mg/mL
BNC680174-500 1x 500 µL

CD45RB (BRA-11G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details