Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adeno-associated virus 2 Protein Rep78 (Rep78), partial

Product Specifications

Abbreviation

Recombinant Adeno-associated virus 2 Rep78 protein, partial

Gene Name

Rep78

UniProt

Q89268

Expression Region

1-210aa

Organism

Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2)

Target Sequence

MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the transfer of neutral lipids, including cholesteryl ester and triglyceride, among lipoprotein particles. Allows the net movement of cholesteryl ester from high density lipoproteins/HDL to triglyceride-rich very low density lipoproteins/VLDL, and the equimolar transport of triglyceride from VLDL to HDL. Regulates the reverse cholesterol transport, by which excess cholesterol is removed from peripheral tissues and returned to the liver for elimination.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

References & Citations

"Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors." Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C. Hum. Mol. Genet. 12:2733-2743 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/468), Biotin conjugate, 0.1mg/mL
BNCB0468-500 1x 500 µL

CD8 (C8/468), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 Rabbit Polyclonal Antibody
TA384255 100 µL

FOXP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hes1 Recombinant Rabbit monoclonal Antibody
HA750240 100 µL

Hes1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SNX8 (C-term) Goat Polyclonal Antibody
AP33411PU-N 100 µg

SNX8 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Fam177a2 Mouse Gene Knockout Kit (CRISPR)
KN500147 1 Kit

Fam177a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BICDL1 Antibody
KC-44946-01 50 μL

BICDL1 Antibody

Sign In for Pricing
View Details