Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1, partial

Product Specifications

Product Name Alternative

Imperatoxin I; IpTx1; IpTxi; Imperatoxin inhibitor; Imperatoxin I large subunit; Imperatoxin I small subunit

Abbreviation

Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1 protein, partial

UniProt

P59888

Expression Region

32-135aa

Organism

Pandinus imperator (Emperor scorpion)

Target Sequence

TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Phospholipase toxin, which may catalyze the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Inhibits both skeletal (RYR1) and cardiac (RYR2) ryanodine receptors (calcium release channels) . Probably blocks ryanodine receptors by generating a lipid product.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHAPI2 / APRIL (8K19) Rabbit Monoclonal Antibody
E28M6252 100 µL

PHAPI2 / APRIL (8K19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ifi47 Mouse shRNA Plasmid (Locus ID 15953)
TL501041 1 Kit

Ifi47 Mouse shRNA Plasmid (Locus ID 15953)

Sign In for Pricing
View Details
Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)
TRV-0055648-01 20 µL

Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)
TRV-0055648-02 100 µL

Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)
TRV-0055648-03 200 µL

Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)
TRV-0055648-04 1 mL

Polyclonal Antibody to DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details