Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein E6 (VACWR062), partial

Product Specifications

Abbreviation

Recombinant Vaccinia virus VACWR062 protein, partial

Gene Name

VACWR062

UniProt

P21607

Expression Region

180-429aa

Organism

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Target Sequence

IWAYLSKKDTGIEFADNDRQDIYTLFQQTGRIVHSNLTETFRDYIFPGDKTSYWVWLNESIANDADIVLNRHAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNERIMSLFSTSAADIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLHESD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Late protein which plays an essential role in virion assembly. Participates in the correct localization and aggregation of the viral core proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.7 kDa

References & Citations

"The vaccinia virus E6 protein influences virion protein localization during virus assembly." Condit R.C., Moussatche N. Virology 482:147-156 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuroligin 4 (NLGN4Y) Rabbit Polyclonal Antibody
TA379153 100 µL

Neuroligin 4 (NLGN4Y) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GADD45B activation kit by CRISPRa
GA103059 1 Kit

Human GADD45B activation kit by CRISPRa

Sign In for Pricing
View Details
SR1 (SRI) (NM_198901) Human Over-expression Lysate
LY403696 100 µg

SR1 (SRI) (NM_198901) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ncf2 activation kit by CRISPRa
GA202838 1 Kit

Mouse Ncf2 activation kit by CRISPRa

Sign In for Pricing
View Details
96 Well Gradient Thermal Cycler BTHC-106
BTHC-106 1 Unit

96 Well Gradient Thermal Cycler BTHC-106

Sign In for Pricing
View Details
Human MACC1 activation kit by CRISPRa
GA117625 1 Kit

Human MACC1 activation kit by CRISPRa

Sign In for Pricing
View Details