Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-2, Mouse (His)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF-2 Protein, Mouse (His), consists of 144 amino acids, produced by E.coli with tag free.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-2-protein-mouse-his.html

Purity

96

Smiles

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) P15655 (A11-S154) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/515), CF405S conjugate, 0.1mg/mL
BNC040515-500 1x 500 µL

CD79a (IGA/515), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD33 (C33/69), CF740 conjugate, 0.1mg/mL
BNC740069-500 1x 500 µL

CD33 (C33/69), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details