Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin 6 receptor (IL6R), partial

Product Specifications

Abbreviation

Recombinant Rabbit IL6R protein, partial

Gene Name

IL6R

UniProt

G1TBG5

Expression Region

76-385aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

LAPGGCPVLEVASNVVSSQPGASVTLTCPGEELADNANVQWTLGGPPETSRHGLWAGVGRRLLLRSVQLGDSGNYSCYLNGYPVGSVCLLVDVPPEEPRLSCFRRSLISPVTCEWRPQRPPSPTTKAVLVVKKFLNGPANDFQKPCQYSHHSQKFSCQLAIPETDRSSHIVSLCVANTVGSKSSRWEVFDGYEILQPDPPANITVTAMVGKPRWLHVTWQDPSSWNSYFYRLRFELRYRAEQSQDFTAWMVEGRSHRVTRLGAQGLQHHSIIHDAWKGVRHVVQLRAQEEFGHGSWSTWSAEVLGTPWTG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM5 (NM_017888) Human Recombinant Protein
TP309798 20 µg

ACSM5 (NM_017888) Human Recombinant Protein

Sign In for Pricing
View Details
PC4 (SUB1) Human qPCR Primer Pair (NM_006713)
HP209611 200 Reactions

PC4 (SUB1) Human qPCR Primer Pair (NM_006713)

Sign In for Pricing
View Details
NAP1L1 (hNRP, HSP22 like Protein interacting Protein, NAP 1, NAP 1 Related Protein, NAP 1L, NAP-1 Related Protein, NAP-1-Related Protein, NAP1, NAP1 L1, NAP1 Related Protein, NAP1L, Nap1l1, NAP1L1 Protein, NP1L1_HUMAN, NRP, Nucleosome assembly Protein 1 like 1, Nucleosome assembly Protein 1-like 1, Nucleosome assembly Protein I-Related Protein, ) discontinued
224407-01 50 µL

NAP1L1 (hNRP, HSP22 like Protein interacting Protein, NAP 1, NAP 1 Related Protein, NAP 1L, NAP-1 Related Protein, NAP-1-Related Protein, NAP1, NAP1 L1, NAP1 Related Protein, NAP1L, Nap1l1, NAP1L1 Protein, NP1L1_HUMAN, NRP, Nucleosome assembly Protein 1 like 1, Nucleosome assembly Protein 1-like 1, Nucleosome assembly Protein I-Related Protein, ) discontinued

Sign In for Pricing
View Details
NAP1L1 (hNRP, HSP22 like Protein interacting Protein, NAP 1, NAP 1 Related Protein, NAP 1L, NAP-1 Related Protein, NAP-1-Related Protein, NAP1, NAP1 L1, NAP1 Related Protein, NAP1L, Nap1l1, NAP1L1 Protein, NP1L1_HUMAN, NRP, Nucleosome assembly Protein 1 like 1, Nucleosome assembly Protein 1-like 1, Nucleosome assembly Protein I-Related Protein, ) discontinued
224407-02 100 µL

NAP1L1 (hNRP, HSP22 like Protein interacting Protein, NAP 1, NAP 1 Related Protein, NAP 1L, NAP-1 Related Protein, NAP-1-Related Protein, NAP1, NAP1 L1, NAP1 Related Protein, NAP1L, Nap1l1, NAP1L1 Protein, NP1L1_HUMAN, NRP, Nucleosome assembly Protein 1 like 1, Nucleosome assembly Protein 1-like 1, Nucleosome assembly Protein I-Related Protein, ) discontinued

Sign In for Pricing
View Details
CARHSP1 (HRP)
557381-01 50 µg

CARHSP1 (HRP)

Sign In for Pricing
View Details
CARHSP1 (HRP)
557381-02 100 µg

CARHSP1 (HRP)

Sign In for Pricing
View Details