Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Mouse

IL-1RN protein serves as an anti-inflammatory antagonist, targeting proinflammatory cytokines IL1B and IL1A within the interleukin-1 family. Playing a protective role, it prevents immune dysregulation and systemic inflammation induced by IL1, particularly in response to innate stimulatory agents. IL-1RN's regulatory activity contributes to a balanced immune response, safeguarding the host from the detrimental effects of excessive inflammation. IL-1RA/IL-1RN Protein, Mouse is the recombinant mouse-derived IL-1RA/IL-1RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-mouse.html

Purity

95.00

Smiles

RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Molecular Formula

16181 (Gene_ID) P25085-1 (R27-Q178) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tylosin Tartrate
TRC-T947655-5G 5 g

Tylosin Tartrate

Sign In for Pricing
View Details
TNF-alpha (Tumor Necrosis Factor alpha), CF647 conjugate, 0.1mg/mL
BNC471674-500 1x 500 µL

TNF-alpha (Tumor Necrosis Factor alpha), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-700-01 50 μL

SLC32A1 Antibody

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-700-02 100 µL

SLC32A1 Antibody

Sign In for Pricing
View Details