Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Mouse

IL-1RN protein serves as an anti-inflammatory antagonist, targeting proinflammatory cytokines IL1B and IL1A within the interleukin-1 family. Playing a protective role, it prevents immune dysregulation and systemic inflammation induced by IL1, particularly in response to innate stimulatory agents. IL-1RN's regulatory activity contributes to a balanced immune response, safeguarding the host from the detrimental effects of excessive inflammation. IL-1RA/IL-1RN Protein, Mouse is the recombinant mouse-derived IL-1RA/IL-1RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-mouse.html

Purity

95.00

Smiles

RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Molecular Formula

16181 (Gene_ID) P25085-1 (R27-Q178) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF568 conjugate, 0.1mg/mL
BNC681888-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UG-01 25 µg

PE/Cyanine5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UG-02 100 µg

PE/Cyanine5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS701314 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
MTH1 (NUDT1) Rabbit Polyclonal Antibody
TA379394 100 µL

MTH1 (NUDT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MVK (NM_001114185) Human Recombinant Protein
TP325616 20 µg

MVK (NM_001114185) Human Recombinant Protein

Sign In for Pricing
View Details