Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Mouse

IL-1RN protein serves as an anti-inflammatory antagonist, targeting proinflammatory cytokines IL1B and IL1A within the interleukin-1 family. Playing a protective role, it prevents immune dysregulation and systemic inflammation induced by IL1, particularly in response to innate stimulatory agents. IL-1RN's regulatory activity contributes to a balanced immune response, safeguarding the host from the detrimental effects of excessive inflammation. IL-1RA/IL-1RN Protein, Mouse is the recombinant mouse-derived IL-1RA/IL-1RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-mouse.html

Purity

95.00

Smiles

RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Molecular Formula

16181 (Gene_ID) P25085-1 (R27-Q178) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S protein RBD (K417N), His Tag (MALS verified)
SPD-C52Hs-1mg 1 mg

SARS-CoV-2 S protein RBD (K417N), His Tag (MALS verified)

Sign In for Pricing
View Details
TTC23 (NM_001288616) Human Tagged ORF Clone
RG238287 10 µg

TTC23 (NM_001288616) Human Tagged ORF Clone

Sign In for Pricing
View Details
trans-2-Butene-1,4-diol
TRC-B754450-5G 5 g

trans-2-Butene-1,4-diol

Sign In for Pricing
View Details
MT1HL1 (NM_001039954) Human Over-expression Lysate
LY421863 100 µg

MT1HL1 (NM_001039954) Human Over-expression Lysate

Sign In for Pricing
View Details
SH3GL3 (NM_003027) Human Over-expression Lysate
LY418948 100 µg

SH3GL3 (NM_003027) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc159 Mouse Gene Knockout Kit (CRISPR)
KN502676 1 Kit

Ccdc159 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details