Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 peptide derivative

Product Specifications

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Molecular Formula

NA

Molecular Weight

3692.15

Shipping Conditions

Ice Packs

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENDOG Rabbit Polyclonal Antibody
orb1546476-01 50 μL

ENDOG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENDOG Rabbit Polyclonal Antibody
orb1546476-02 100 µL

ENDOG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CUL4A Protein, N-His-SUMO & C-Strep
YHG61501 100 μg

Recombinant Human CUL4A Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
TAP26/CCDC59 Rabbit pAb
E47R13806 100 µL

TAP26/CCDC59 Rabbit pAb

Sign In for Pricing
View Details
CORO2A Human Gene Knockout Kit (CRISPR)
KN400403 1 Kit

CORO2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
pCR-BluntII-TOPO-WFDC10B Plasmid
PVT30514 2 µg

pCR-BluntII-TOPO-WFDC10B Plasmid

Sign In for Pricing
View Details